PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00079935001
Common NameGSBRNA2T00079935001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 128aa    MW: 14303.6 Da    PI: 7.8092
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00079935001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26075.21.2e-23121111100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +C++C  +++ C+++C +a yfp+e + +++++ klFG+ n+++++k +p+e+++ ++ss++ e+ a+++d + G +gvi+kl+ +++ +
  GSBRNA2T00079935001  12 RCCVCIEKNKICTRKCEFAAYFPNEMQGDYEAATKLFGTPNITRMMKLAPHEQKHLLASSILKEGVAWTDDNIGGGCGVIQKLRGEIKLH 101
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +  l+ ++++
  GSBRNA2T00079935001 102 EDYLSDIRKK 111
                          *999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.80511112IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-1912107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MEAVGTDTKH GRCCVCIEKN KICTRKCEFA AYFPNEMQGD YEAATKLFGT PNITRMMKLA  60
PHEQKHLLAS SILKEGVAWT DDNIGGGCGV IQKLRGEIKL HEDYLSDIRK KISEEKKELV  120
LLSNPYI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00079935001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607622.11e-68PREDICTED: LOB domain-containing protein 5-like
SwissprotQ9C8V81e-36LBD5_ARATH; LOB domain-containing protein 5
TrEMBLA0A078I5721e-91A0A078I572_BRANA; BnaA07g07870D protein
STRINGAT1G36000.13e-34(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.18e-38LOB domain-containing protein 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]